PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr003370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 376aa    MW: 40208.5 Da    PI: 7.415
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr003370.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.1e-185198148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEdell++++k+ G g+W+t +++ g+ R++k+c++rw +yl
      Pbr003370.1 51 RGPWTPEEDELLANYIKKEGEGRWRTLPKRAGLLRCGKSCRLRWMNYL 98
                     89******************************99************97 PP

2Myb_DNA-binding46.77.5e-15109149648
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
      Pbr003370.1 109 PDEEDLILRLHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 149
                      89***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-2242100IPR009057Homeodomain-like
PROSITE profilePS5129416.8184698IPR017930Myb domain
SuperFamilySSF466894.77E-2948145IPR009057Homeodomain-like
SMARTSM007177.9E-1450100IPR001005SANT/Myb domain
PfamPF002494.4E-165198IPR001005SANT/Myb domain
CDDcd001671.08E-115398No hitNo description
PROSITE profilePS5129424.39799153IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-24101154IPR009057Homeodomain-like
SMARTSM007172.7E-13103151IPR001005SANT/Myb domain
CDDcd001671.56E-11109149No hitNo description
PfamPF002491.2E-13109149IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MRNPSPSSKA AAAAASAKMQ TTITASSSSS KAAGVAGGTK TPCCAKVGLK RGPWTPEEDE  60
LLANYIKKEG EGRWRTLPKR AGLLRCGKSC RLRWMNYLRP SVKRGQIAPD EEDLILRLHR  120
LLGNRWSLIA GRIPGRTDNE IKNYWNTHLS KKLINQGIDP RTHKPLNPDH HSAADDADLD  180
NTNKSTAVAS SSKANDRFSN PNPSPPSDRL VHKEGDPNNS RNGGNIAIDD HDQGTIVHGY  240
ANMITSINNP DASSSATATG TLSLRSNNSH GGVLLGGGGN EEDDDINCCA DDVFSSFLNS  300
LINEDPFHGQ HQLQQVLQNG NVSAHAAAAG SENLPLITMT GASTTAPSTF GWESAVLMSS  360
AFIHNDHQRV NDPTE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25491535108B-MYB
1mse_C1e-25491532105C-Myb DNA-Binding Domain
1msf_C1e-25491532105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0201120.0KJ020112.1 Malus hybrid cultivar MYB12a protein (MYB12a) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009364138.10.0PREDICTED: transcription repressor MYB5-like
RefseqXP_009364137.10.0PREDICTED: transcription repressor MYB5-like
TrEMBLS5FZE30.0S5FZE3_MALDO; MYB transcription factor
STRINGVIT_06s0004g00570.t011e-107(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38943064
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.14e-80myb domain protein 5